Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF25 Peptide - N-terminal region

ZNF25 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNF25, KOX19

UniProt

P17030

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF25 Rabbit Polyclonal Antibody (orb573888) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005252443

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYQESQAGNSRNGELTKHQKTHTTEKACECKECGKFFCQKSALIVHQHTH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Platelet Factor 4 (PF4)
TRV-0005973-01 24 Tests

ELISA Kit for Platelet Factor 4 (PF4)

Sign In for Pricing
View Details
ELISA Kit for Platelet Factor 4 (PF4)
TRV-0005973-02 48 Tests

ELISA Kit for Platelet Factor 4 (PF4)

Sign In for Pricing
View Details
ELISA Kit for Platelet Factor 4 (PF4)
TRV-0005973-03 96 Tests

ELISA Kit for Platelet Factor 4 (PF4)

Sign In for Pricing
View Details
ELISA Kit for Platelet Factor 4 (PF4)
TRV-0005973-04 5x 96 Tests

ELISA Kit for Platelet Factor 4 (PF4)

Sign In for Pricing
View Details
ELISA Kit for Platelet Factor 4 (PF4)
TRV-0005973-05 10x 96 Tests

ELISA Kit for Platelet Factor 4 (PF4)

Sign In for Pricing
View Details
Methyl 5-[4- (trifluoromethyl) phenyl]-2-thiophenecarboxylate
PC1026515-01 250 mg

Methyl 5-[4- (trifluoromethyl) phenyl]-2-thiophenecarboxylate

Sign In for Pricing
View Details