Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF25 Peptide - N-terminal region

ZNF25 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNF25, KOX19

UniProt

P17030

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF25 Rabbit Polyclonal Antibody (orb573888) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005252443

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYQESQAGNSRNGELTKHQKTHTTEKACECKECGKFFCQKSALIVHQHTH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL8A Recombinant Protein Antigen
NBP2-14314PEP 0.1 mL

ARL8A Recombinant Protein Antigen

Sign In for Pricing
View Details
RAB40B Antibody, FITC conjugated
A54598-50UG 50 µg

RAB40B Antibody, FITC conjugated

Sign In for Pricing
View Details
8-chloroquinolin-5-amine hydrochloride
sc-351607 250 mg

8-chloroquinolin-5-amine hydrochloride

Sign In for Pricing
View Details
Rep15 3'UTR GFP Stable Cell Line
TU267475 1.0 mL

Rep15 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
8- (Bromomethyl) -3-methylisoquinoline hydrobromide
OR1004372 1 g

8- (Bromomethyl) -3-methylisoquinoline hydrobromide

Sign In for Pricing
View Details
Chicken A-kinase anchor protein 11 (AKAP11) ELISA Kit
MBS2606238-01 48 Well

Chicken A-kinase anchor protein 11 (AKAP11) ELISA Kit

Sign In for Pricing
View Details