P2RX2 Peptide - middle region
P2RX2 Peptide - middle region
Product Specifications
Product Name Alternative
P2RX2, P2X2
UniProt
Q9UBL9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with P2RX2 Rabbit Polyclonal Antibody (orb575522) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKH
More Discoveries
Explore Other Products
Browse additional items from our catalog
sc-344437 1 g
3- (4-Iodo-2-ureido-phenyl) -propionic acid ethyl ester
Sign In for Pricing
View Details 
NBP3-06163AF750 0.1 mL
Mouse Monoclonal PHYH Antibody (01) [Alexa Fluor 750]
Sign In for Pricing
View Details