Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNOT8 Peptide - C-terminal region

CNOT8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CNOT8, CALIF, POP2

UniProt

Q9UFF9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAGE2 (NM_182482) Human Recombinant Protein
TP319432L 1 mg

BAGE2 (NM_182482) Human Recombinant Protein

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD5 Antibody
RD22035F-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse CD5 Antibody

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD5 Antibody
RD22035F-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse CD5 Antibody

Sign In for Pricing
View Details
7-O-(Triethylsilyl)-10-deacetyl Baccatin III
TRC-T778000-25MG 25 mg

7-O-(Triethylsilyl)-10-deacetyl Baccatin III

Sign In for Pricing
View Details
Histone H2A (Ab-5) Antibody
8D0022-AAT 50 µg

Histone H2A (Ab-5) Antibody

Sign In for Pricing
View Details
Iron(III) Oxide
TRC-I775210-5G 5 g

Iron(III) Oxide

Sign In for Pricing
View Details