ARMH3 Peptide - C-terminal region
ARMH3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C10orf76
UniProt
Q5T2E6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARMH3 Rabbit Polyclonal Antibody (orb325515) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VRANYDTLTLKLQDGLDQYERYSEQHKEAAFFKELVRSISTNVRRNLAFH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6437349-01 0.1 mL
SFTPA1 (Pulmonary Surfactant-associated Protein A1, SPA, PSAP, PSPA, SP-A, SPA1, PSP-A, SFTP1, SP-A1, COLEC4, SFTPA1B) (MaxLight 550)
Sign In for Pricing
View Details MBS6437349-02 5x 0.1 mL
SFTPA1 (Pulmonary Surfactant-associated Protein A1, SPA, PSAP, PSPA, SP-A, SPA1, PSP-A, SFTP1, SP-A1, COLEC4, SFTPA1B) (MaxLight 550)
Sign In for Pricing
View Details 