Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMH3 Peptide - C-terminal region

ARMH3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C10orf76

UniProt

Q5T2E6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARMH3 Rabbit Polyclonal Antibody (orb325515) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRANYDTLTLKLQDGLDQYERYSEQHKEAAFFKELVRSISTNVRRNLAFH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Salivary Duct Autoantibody ELISA Kit
MBS014548-01 48 Well

Canine Salivary Duct Autoantibody ELISA Kit

Sign In for Pricing
View Details
Canine Salivary Duct Autoantibody ELISA Kit
MBS014548-02 96 Well

Canine Salivary Duct Autoantibody ELISA Kit

Sign In for Pricing
View Details
Canine Salivary Duct Autoantibody ELISA Kit
MBS014548-03 5x 96 Well

Canine Salivary Duct Autoantibody ELISA Kit

Sign In for Pricing
View Details
Canine Salivary Duct Autoantibody ELISA Kit
MBS014548-04 10x 96 Well

Canine Salivary Duct Autoantibody ELISA Kit

Sign In for Pricing
View Details
Boc-D-cyclopentylglycine dicyclohexylammonium salt
sc-478782A 250 mg

Boc-D-cyclopentylglycine dicyclohexylammonium salt

Sign In for Pricing
View Details
CD2 Antibody
CSB-PA004894LA01HU-01 50 µg

CD2 Antibody

Sign In for Pricing
View Details