Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP41 Peptide - N-terminal region

ZFP41 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZFP41

UniProt

Q8N8Y5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZFP41 Rabbit Polyclonal Antibody (orb325607) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRTEPCLSPEDEEHVFDAFDASFKDDFEGVPVFIPFQRKKPYECSECGRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA kit for Human KIM-1 (Kidney Injury Molecule 1)
E-EL-H0186 96 Tests

ELISA kit for Human KIM-1 (Kidney Injury Molecule 1)

Sign In for Pricing
View Details
SNRPN 3'UTR Luciferase Stable Cell Line
TU024255 1.0 mL

SNRPN 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal Integrin beta 1D Antibody (AT47E2) [Allophycocyanin]
NBP2-61161APC 0.1 mL

Mouse Monoclonal Integrin beta 1D Antibody (AT47E2) [Allophycocyanin]

Sign In for Pricing
View Details
TMCC2 (NM_014858) Human Tagged ORF Clone
RC213684 10 µg

TMCC2 (NM_014858) Human Tagged ORF Clone

Sign In for Pricing
View Details
CTHRC1 Rabbit Polyclonal Antibody
orb2954712-01 50 µg

CTHRC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CTHRC1 Rabbit Polyclonal Antibody
orb2954712-02 100 µg

CTHRC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details