Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP41 Peptide - N-terminal region

ZFP41 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZFP41

UniProt

Q8N8Y5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZFP41 Rabbit Polyclonal Antibody (orb325607) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRTEPCLSPEDEEHVFDAFDASFKDDFEGVPVFIPFQRKKPYECSECGRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbm9 Antibody - C-terminal region
ARP37433_P050-25UL 25 µL

Rbm9 Antibody - C-terminal region

Sign In for Pricing
View Details
5-Aminopyrimidine-4,6-dithiol
ECA66092-01 50 mg

5-Aminopyrimidine-4,6-dithiol

Sign In for Pricing
View Details
5-Aminopyrimidine-4,6-dithiol
ECA66092-02 0.5 g

5-Aminopyrimidine-4,6-dithiol

Sign In for Pricing
View Details
Recombinant Homing Associated Cell Adhesion Molecule (HCAM)
SIPA451Mu03-01 10 µg

Recombinant Homing Associated Cell Adhesion Molecule (HCAM)

Sign In for Pricing
View Details
Recombinant Homing Associated Cell Adhesion Molecule (HCAM)
SIPA451Mu03-02 50 µg

Recombinant Homing Associated Cell Adhesion Molecule (HCAM)

Sign In for Pricing
View Details
Recombinant Homing Associated Cell Adhesion Molecule (HCAM)
SIPA451Mu03-03 200 µg

Recombinant Homing Associated Cell Adhesion Molecule (HCAM)

Sign In for Pricing
View Details