SVOPL Peptide - C-terminal region
SVOPL Peptide - C-terminal region
Product Specifications
Product Name Alternative
SVOPL
UniProt
Q8N434
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SVOPL Rabbit Polyclonal Antibody (orb325850) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC743410-500 1x 500 µL
CD20 / MS4A1 (B-Cell Marker) (MS4A1/3410), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TP324550 20 µg
Mammaglobin A (SCGB2A2) (NM_002411) Human Recombinant Protein
Sign In for Pricing
View Details 