Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SVOPL Peptide - C-terminal region

SVOPL Peptide - C-terminal region

Product Specifications

Product Name Alternative

SVOPL

UniProt

Q8N434

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SVOPL Rabbit Polyclonal Antibody (orb325850) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bromoridane Hydrobromide
TRC-B689200-25MG 25 mg

Bromoridane Hydrobromide

Sign In for Pricing
View Details
Cyclosporin G
TRC-C990143-50MG 50 mg

Cyclosporin G

Sign In for Pricing
View Details
Purified Anti-Human CD40 Antibody[3A8]
E-AB-F1037A-01 25 µg

Purified Anti-Human CD40 Antibody[3A8]

Sign In for Pricing
View Details
Purified Anti-Human CD40 Antibody[3A8]
E-AB-F1037A-02 100 µg

Purified Anti-Human CD40 Antibody[3A8]

Sign In for Pricing
View Details
Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3295), 0.2mg/mL
BNUB3295-100 1x 100 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3295), 0.2mg/mL

Sign In for Pricing
View Details
MPDZ Antibody
KC-39953-01 50 μL

MPDZ Antibody

Sign In for Pricing
View Details