Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANBP9 Peptide - middle region

RANBP9 Peptide - middle region

Product Specifications

Product Name Alternative

BPM-L, BPM90, RANBPM, RanBP7

UniProt

Q96S59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RANBP9 Rabbit Polyclonal Antibody (orb325878) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIG1 Antibody (N-term) [APR14888G]
APR14888G-01 50 µL

AIG1 Antibody (N-term) [APR14888G]

Sign In for Pricing
View Details
AIG1 Antibody (N-term) [APR14888G]
APR14888G-02 100 µL

AIG1 Antibody (N-term) [APR14888G]

Sign In for Pricing
View Details
AIG1 Antibody (N-term) [APR14888G]
APR14888G-03 200 µL

AIG1 Antibody (N-term) [APR14888G]

Sign In for Pricing
View Details
AIG1 Antibody (N-term) [APR14888G]
APR14888G-04 400 µL

AIG1 Antibody (N-term) [APR14888G]

Sign In for Pricing
View Details
ADCK4 (COQ8B) (NM_001142555) Human Over-expression Lysate
LC428173 20 µg

ADCK4 (COQ8B) (NM_001142555) Human Over-expression Lysate

Sign In for Pricing
View Details
HtrA siRNA (m)
sc-60083 10 µM

HtrA siRNA (m)

Sign In for Pricing
View Details