Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANBP9 Peptide - middle region

RANBP9 Peptide - middle region

Product Specifications

Product Name Alternative

BPM-L, BPM90, RANBPM, RanBP7

UniProt

Q96S59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RANBP9 Rabbit Polyclonal Antibody (orb325878) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC35B1 Antibody, Biotin conjugated
A35013-50UG 50 µg

SLC35B1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Daam1 sgRNA CRISPR Lentivector set (Rat)
K6718401 3x 1.0 µg

Daam1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
RNY1P6 Recombinant Protein (Human)
RP089565 100 µg

RNY1P6 Recombinant Protein (Human)

Sign In for Pricing
View Details
Hsa-miR-4297 agomir
HY-R00977A-01 5 nmol

Hsa-miR-4297 agomir

Sign In for Pricing
View Details
Hsa-miR-4297 agomir
HY-R00977A-02 20 nmol

Hsa-miR-4297 agomir

Sign In for Pricing
View Details
Vmn1r31 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3074203 1.0 µg DNA

Vmn1r31 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details