Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL Peptide - N-terminal region

CHODL Peptide - N-terminal region

Product Specifications

Product Name Alternative

CHODL, C21orf68, PRED12, UNQ872/PRO1890

UniProt

Q9H9P2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHODL Rabbit Polyclonal Antibody (orb582223) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIF27 Peptide - C-terminal region
orb2005281 100 µg

KIF27 Peptide - C-terminal region

Sign In for Pricing
View Details
10-Oxo Naloxone discontinued
411666-01 1 mg

10-Oxo Naloxone discontinued

Sign In for Pricing
View Details
10-Oxo Naloxone discontinued
411666-02 10 mg

10-Oxo Naloxone discontinued

Sign In for Pricing
View Details
FAU, CT (Ubiquitin-like Protein FUBI) (FITC) discontinued
F0020-20A-FITC 200 µL

FAU, CT (Ubiquitin-like Protein FUBI) (FITC) discontinued

Sign In for Pricing
View Details
Recombinant Macaca mulatta (Rhesus macaque) Amyloid protein A (SAA1)
MBS1279153-01 0.02 mg (E-Coli)

Recombinant Macaca mulatta (Rhesus macaque) Amyloid protein A (SAA1)

Sign In for Pricing
View Details
Recombinant Macaca mulatta (Rhesus macaque) Amyloid protein A (SAA1)
MBS1279153-02 0.1 mg (E-Coli)

Recombinant Macaca mulatta (Rhesus macaque) Amyloid protein A (SAA1)

Sign In for Pricing
View Details