Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL Peptide - N-terminal region

CHODL Peptide - N-terminal region

Product Specifications

Product Name Alternative

CHODL, C21orf68, PRED12, UNQ872/PRO1890

UniProt

Q9H9P2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHODL Rabbit Polyclonal Antibody (orb582223) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL18 (NM_000979) Human Over-expression Lysate
LS006141-20ug 20 µg

RPL18 (NM_000979) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral mouse Dus1l shRNA (UAS) - Lentiviral mouse Dus1l shRNA (UAS, RFP) plasmid
GTR15169249 1 Vial

Lentiviral mouse Dus1l shRNA (UAS) - Lentiviral mouse Dus1l shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Mouse Monoclonal p27/Kip1 Antibody (7B9) [Janelia Fluor 646]
NBP2-59444JF646 0.1 mL

Mouse Monoclonal p27/Kip1 Antibody (7B9) [Janelia Fluor 646]

Sign In for Pricing
View Details
Recombinant Rat SerpinF1/ PEDF Protein, GST, E.coli-50ug
QP6675-ec-50ug 50ug

Recombinant Rat SerpinF1/ PEDF Protein, GST, E.coli-50ug

Sign In for Pricing
View Details
CCR5 antibody
70R-30663 100 ug

CCR5 antibody

Sign In for Pricing
View Details
CHST2 Lentiviral Activation Particles (h)
sc-411281-LAC 200 µL

CHST2 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details