Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1A Peptide - N-terminal region

IL1A Peptide - N-terminal region

Product Specifications

Product Name Alternative

IL1A, IL1F1

UniProt

P01583

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL1A Rabbit Polyclonal Antibody (orb333724) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000566

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Niobium, Zirconium-99,1 Wire 2 mm diameter
GX5159-1m 1 m

Niobium, Zirconium-99,1 Wire 2 mm diameter

Sign In for Pricing
View Details
PAP, Human (Prostatic Acid Phosphatase, ACPP, ACP3, ACP-3, 5'-Nucleotidase, 5'-NT, Ecto-5'-nucleotidase, Thiamine Monophosphatase, TMPase)
138204 1 mg

PAP, Human (Prostatic Acid Phosphatase, ACPP, ACP3, ACP-3, 5'-Nucleotidase, 5'-NT, Ecto-5'-nucleotidase, Thiamine Monophosphatase, TMPase)

Sign In for Pricing
View Details
N- (3,5-dichlorophenyl) -1-phenylcyclopentane-1-carboxamide
XQB45512 250 mg

N- (3,5-dichlorophenyl) -1-phenylcyclopentane-1-carboxamide

Sign In for Pricing
View Details
Rabbit Polyclonal Histone Deacetylase 2/HDAC2 Antibody [DyLight 650]
NBP2-41285C 0.1 mL

Rabbit Polyclonal Histone Deacetylase 2/HDAC2 Antibody [DyLight 650]

Sign In for Pricing
View Details
HOPX (NM_032495) Human Tagged Lenti ORF Clone
RC222859L3 10 µg

HOPX (NM_032495) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CD15 Antibody (FITC)
GWB-E44272 0.02 mg

CD15 Antibody (FITC)

Sign In for Pricing
View Details