Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1A Peptide - N-terminal region

IL1A Peptide - N-terminal region

Product Specifications

Product Name Alternative

IL1A, IL1F1

UniProt

P01583

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL1A Rabbit Polyclonal Antibody (orb333724) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000566

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYL9 Antibody, FITC conjugated
A29246-50UG 50 µg

MYL9 Antibody, FITC conjugated

Sign In for Pricing
View Details
ZSWIM7 (SWS1)
470215 50 µg

ZSWIM7 (SWS1)

Sign In for Pricing
View Details
EFCAB4B, NT (EFCAB4B, CRACR2A, EF-hand calcium-binding domain-containing protein 4B, Calcium release-activated calcium channel regulator 2A) (AP)
MBS6294500-01 0.2 mL

EFCAB4B, NT (EFCAB4B, CRACR2A, EF-hand calcium-binding domain-containing protein 4B, Calcium release-activated calcium channel regulator 2A) (AP)

Sign In for Pricing
View Details
EFCAB4B, NT (EFCAB4B, CRACR2A, EF-hand calcium-binding domain-containing protein 4B, Calcium release-activated calcium channel regulator 2A) (AP)
MBS6294500-02 5x 0.2 mL

EFCAB4B, NT (EFCAB4B, CRACR2A, EF-hand calcium-binding domain-containing protein 4B, Calcium release-activated calcium channel regulator 2A) (AP)

Sign In for Pricing
View Details
Cesium Chloride
MBS635276-01 100 g

Cesium Chloride

Sign In for Pricing
View Details
Cesium Chloride
MBS635276-02 500 g

Cesium Chloride

Sign In for Pricing
View Details