Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAH6 Peptide - middle region

DNAH6 Peptide - middle region

Product Specifications

Product Name Alternative

HL2, HL-2, DNHL1, Dnahc6

UniProt

Q9C0G6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAH6 Rabbit Polyclonal Antibody (orb326024) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDAVALRPTRNVGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

7-MAD-MDCPT hydrochloride
T211085-01 10 mg

7-MAD-MDCPT hydrochloride

Sign In for Pricing
View Details
7-MAD-MDCPT hydrochloride
T211085-02 50 mg

7-MAD-MDCPT hydrochloride

Sign In for Pricing
View Details
Hamster FK506 Binding Protein 1A ELISA Kit
MBS067636-01 48 Well

Hamster FK506 Binding Protein 1A ELISA Kit

Sign In for Pricing
View Details
Hamster FK506 Binding Protein 1A ELISA Kit
MBS067636-02 96 Well

Hamster FK506 Binding Protein 1A ELISA Kit

Sign In for Pricing
View Details
Hamster FK506 Binding Protein 1A ELISA Kit
MBS067636-03 5x 96 Well

Hamster FK506 Binding Protein 1A ELISA Kit

Sign In for Pricing
View Details
Hamster FK506 Binding Protein 1A ELISA Kit
MBS067636-04 10x 96 Well

Hamster FK506 Binding Protein 1A ELISA Kit

Sign In for Pricing
View Details