Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAH6 Peptide - middle region

DNAH6 Peptide - middle region

Product Specifications

Product Name Alternative

HL2, HL-2, DNHL1, Dnahc6

UniProt

Q9C0G6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAH6 Rabbit Polyclonal Antibody (orb326024) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDAVALRPTRNVGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5,5'- (Furan-2-ylmethylene) bis (2-methylfuran)
OR1056976-01 100 mg

5,5'- (Furan-2-ylmethylene) bis (2-methylfuran)

Sign In for Pricing
View Details
5,5'- (Furan-2-ylmethylene) bis (2-methylfuran)
OR1056976-02 250 mg

5,5'- (Furan-2-ylmethylene) bis (2-methylfuran)

Sign In for Pricing
View Details
5,5'- (Furan-2-ylmethylene) bis (2-methylfuran)
OR1056976-03 1 g

5,5'- (Furan-2-ylmethylene) bis (2-methylfuran)

Sign In for Pricing
View Details
M Sirt3 Antibody (C-term)
E45R07038G-1 100 µL

M Sirt3 Antibody (C-term)

Sign In for Pricing
View Details
SensiStain™ Anti-Lysozyme Antibody
HY500150 0.1 mL

SensiStain™ Anti-Lysozyme Antibody

Sign In for Pricing
View Details
Triclocarban
T4504-01 1 g

Triclocarban

Sign In for Pricing
View Details