Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC20 Peptide - N-terminal region

LRRC20 Peptide - N-terminal region

Product Specifications

Product Name Alternative

UNQ2429/PRO4989

UniProt

Q8TCA0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC20 Rabbit Polyclonal Antibody (orb326154) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLKKMGEAVARVARKVNETVESGSDTLELHLEGNFLHRLPSEVSALQHLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-100 1x 100 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-(3-Chlorophenyl)-2-(3-(1-(3-chlorophenyl)piperazin-2-yl)propyl)-4-nitrosopiperazine
TRC-C972980-50MG 50 mg

1-(3-Chlorophenyl)-2-(3-(1-(3-chlorophenyl)piperazin-2-yl)propyl)-4-nitrosopiperazine

Sign In for Pricing
View Details
APOL6 Rabbit Polyclonal Antibody
TA383741 100 µL

APOL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD45 / LCA (2B11), 0.2mg/mL
BNUB0470-500 1x 500 µL

CD45 / LCA (2B11), 0.2mg/mL

Sign In for Pricing
View Details
Palmitelaidic Acid
TRC-P144005-250MG 250 mg

Palmitelaidic Acid

Sign In for Pricing
View Details
SIGLEC10 (NM_001171157) Human Over-expression Lysate
LC433331 20 µg

SIGLEC10 (NM_001171157) Human Over-expression Lysate

Sign In for Pricing
View Details