Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC20 Peptide - N-terminal region

LRRC20 Peptide - N-terminal region

Product Specifications

Product Name Alternative

UNQ2429/PRO4989

UniProt

Q8TCA0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC20 Rabbit Polyclonal Antibody (orb326154) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLKKMGEAVARVARKVNETVESGSDTLELHLEGNFLHRLPSEVSALQHLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UQCRH Rabbit Polyclonal Antibody
TA365201 100 µL

UQCRH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDS1 (N-term) Rabbit Polyclonal Antibody
AP46043PU-N 100 µL

CDS1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Turpentine Oil
TRC-T785900-50ML 50 mL

Turpentine Oil

Sign In for Pricing
View Details
Diclofenac Ethyl Ester
TRC-D436495-50MG 50 mg

Diclofenac Ethyl Ester

Sign In for Pricing
View Details
Histone H3 Rabbit Polyclonal Antibody
AP20241PU-N 100 µg

Histone H3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Setd6 Mouse Gene Knockout Kit (CRISPR)
KN515629 1 Kit

Setd6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details