Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT13 Peptide - N-terminal region

TRMT13 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CCDC76

UniProt

Q9NUP7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRMT13 Rabbit Polyclonal Antibody (orb326188) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_061956

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SHPALHDALNDPKNGDSATKHLKQQASILGNIENLKLLGPRRCFVEFGAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENDOG (Endonuclease G, Mitochondrial, Endo G) (HRP)
MBS6269499-01 0.1 mL

ENDOG (Endonuclease G, Mitochondrial, Endo G) (HRP)

Sign In for Pricing
View Details
ENDOG (Endonuclease G, Mitochondrial, Endo G) (HRP)
MBS6269499-02 5x 0.1 mL

ENDOG (Endonuclease G, Mitochondrial, Endo G) (HRP)

Sign In for Pricing
View Details
Rabbit Monoclonal Influenza A Haemagglutinin H1N1 Antibody Pair [HRP]
NBP2-79293-5Plates 5 Plates

Rabbit Monoclonal Influenza A Haemagglutinin H1N1 Antibody Pair [HRP]

Sign In for Pricing
View Details
Horse Melanoma-Associated Antigen C3 (MAGEC3) ELISA Kit
MBS9366440-01 48 Well

Horse Melanoma-Associated Antigen C3 (MAGEC3) ELISA Kit

Sign In for Pricing
View Details
Horse Melanoma-Associated Antigen C3 (MAGEC3) ELISA Kit
MBS9366440-02 96 Well

Horse Melanoma-Associated Antigen C3 (MAGEC3) ELISA Kit

Sign In for Pricing
View Details
Horse Melanoma-Associated Antigen C3 (MAGEC3) ELISA Kit
MBS9366440-03 5x 96 Well

Horse Melanoma-Associated Antigen C3 (MAGEC3) ELISA Kit

Sign In for Pricing
View Details