Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT13 Peptide - N-terminal region

TRMT13 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CCDC76

UniProt

Q9NUP7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRMT13 Rabbit Polyclonal Antibody (orb326188) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_061956

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SHPALHDALNDPKNGDSATKHLKQQASILGNIENLKLLGPRRCFVEFGAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sepiapterin reductase
AP88207 1 mg

Sepiapterin reductase

Sign In for Pricing
View Details
Rabbit Polyclonal Rabex5 Antibody [DyLight 488]
NBP1-76548G 0.1 mL

Rabbit Polyclonal Rabex5 Antibody [DyLight 488]

Sign In for Pricing
View Details
IMPDH-IN-1
T201087-01 10 mg

IMPDH-IN-1

Sign In for Pricing
View Details
IMPDH-IN-1
T201087-02 50 mg

IMPDH-IN-1

Sign In for Pricing
View Details
HRM PCR Master Mix (2x)
E0440-02 500 Reactions

HRM PCR Master Mix (2x)

Sign In for Pricing
View Details
Mouse Monoclonal BAMBI/NMA Antibody (OTI5D5) [DyLight 680]
NBP2-71778FR 0.1 mL

Mouse Monoclonal BAMBI/NMA Antibody (OTI5D5) [DyLight 680]

Sign In for Pricing
View Details