Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC181 Peptide - N-terminal region

CCDC181 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C1orf114

UniProt

Q5TID7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC181 Rabbit Polyclonal Antibody (orb326211) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005245440

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPRRNDIISVPGIQPLDPISDSDSENSFQESKLESQKDLEEEEDEEVRRY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTTG1 Conjugated Antibody
orb1623915 100 µL

PTTG1 Conjugated Antibody

Sign In for Pricing
View Details
CLCN2 Polyclonal Antibody
E44H08192 100 µL

CLCN2 Polyclonal Antibody

Sign In for Pricing
View Details
PRKCA Rabbit pAb
E2500267 100 µL

PRKCA Rabbit pAb

Sign In for Pricing
View Details
2810408A11Rik siRNA (m)
sc-108846 10 µM

2810408A11Rik siRNA (m)

Sign In for Pricing
View Details
NOX2/CYBB/gp91phox (3G4) Rabbit Monoclonal Antibody
E28M4710 100 µL

NOX2/CYBB/gp91phox (3G4) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Porcine PP ELISA Kit
EF016678 96 Tests

Porcine PP ELISA Kit

Sign In for Pricing
View Details