Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC181 Peptide - N-terminal region

CCDC181 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C1orf114

UniProt

Q5TID7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC181 Rabbit Polyclonal Antibody (orb326211) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005245440

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPRRNDIISVPGIQPLDPISDSDSENSFQESKLESQKDLEEEEDEEVRRY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody [FITC]
NBP1-19775F 0.1 mL

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody [FITC]

Sign In for Pricing
View Details
CHO-K1/HEK293 Cells Stable expressing GPCR protein GABBR1 (Protein accession # NM_021904)
cAP-1143 1 Frozen Vial

CHO-K1/HEK293 Cells Stable expressing GPCR protein GABBR1 (Protein accession # NM_021904)

Sign In for Pricing
View Details
LOC100363276 3'UTR GFP Stable Cell Line
TU258653 1.0 mL

LOC100363276 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat Ubiquitin (Ub) ELISA Kit
CSB-E15832r-01 24 Well

Rat Ubiquitin (Ub) ELISA Kit

Sign In for Pricing
View Details
Rat Ubiquitin (Ub) ELISA Kit
CSB-E15832r-02 96 Well

Rat Ubiquitin (Ub) ELISA Kit

Sign In for Pricing
View Details
Rat Ubiquitin (Ub) ELISA Kit
CSB-E15832r-03 5x 96 Well

Rat Ubiquitin (Ub) ELISA Kit

Sign In for Pricing
View Details