USP46 Peptide - middle region
USP46 Peptide - middle region
Product Specifications
UniProt
P62068
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with USP46 Rabbit Polyclonal Antibody (orb584301) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RDFSNTETLCSEQKYYCETCCSKQEAQKRMRVKKLPMILALHLKRFKYME
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RD-ODC-Hu-01 96 Tests
Human Ornithine Decarboxylase (ODC) ELISA Kit
Sign In for Pricing
View Details RD-ODC-Hu-02 48 Tests
Human Ornithine Decarboxylase (ODC) ELISA Kit
Sign In for Pricing
View Details ![HRP Conjugated M13 Recombinant Mouse Monoclonal Antibody [PS00-01]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea8139f/imageurl/ha601057.webp)
HA601057 100 µL
HRP Conjugated M13 Recombinant Mouse Monoclonal Antibody [PS00-01]
Sign In for Pricing
View Details ![Protein Z (PROZ) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A11]](https://cdn.genprice.uk/products/937/68dd1b7d061270361ea1d347/imageurl/ta806674bm.webp)
TA806674BM 100 µL
Protein Z (PROZ) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A11]
Sign In for Pricing
View Details 