Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP2C8 Peptide - N-terminal region

CYP2C8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CPC8, CYPIIC8, CYP2C8DM, MP-12/MP-20

UniProt

P10632

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP2C8 Rabbit Polyclonal Antibody (orb326330) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MFLQPIAKGIISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTTY29P ORF Vector (Human) (pORF)
ORF035298 1.0 µg DNA

TTTY29P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Anti Human CD45 Biotinylated
MBS140146-01 0.5 mg

Mouse Anti Human CD45 Biotinylated

Sign In for Pricing
View Details
Mouse Anti Human CD45 Biotinylated
MBS140146-02 1 mg

Mouse Anti Human CD45 Biotinylated

Sign In for Pricing
View Details
Mouse Anti Human CD45 Biotinylated
MBS140146-03 5x 1 mg

Mouse Anti Human CD45 Biotinylated

Sign In for Pricing
View Details
Human PLA2G2E shRNA Plasmid
abx959341-01 150 µg

Human PLA2G2E shRNA Plasmid

Sign In for Pricing
View Details
Human PLA2G2E shRNA Plasmid
abx959341-02 300 µg

Human PLA2G2E shRNA Plasmid

Sign In for Pricing
View Details