Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP2C8 Peptide - N-terminal region

CYP2C8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CPC8, CYPIIC8, CYP2C8DM, MP-12/MP-20

UniProt

P10632

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP2C8 Rabbit Polyclonal Antibody (orb326330) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MFLQPIAKGIISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLFM3 Antibody
DF15761-01 100 µL

OLFM3 Antibody

Sign In for Pricing
View Details
OLFM3 Antibody
DF15761-02 200 µL

OLFM3 Antibody

Sign In for Pricing
View Details
TXA2R CRISPR/Cas9 KO Plasmid (h)
sc-402468 20 µg

TXA2R CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
SLC16A7 Antibody
orb1260946 100 µL

SLC16A7 Antibody

Sign In for Pricing
View Details
Anti-ARFGEF2 Antibody (R2S24)
RHN81901 100 μg

Anti-ARFGEF2 Antibody (R2S24)

Sign In for Pricing
View Details
Omberacetam (Standard)
HY-17456R-01 5 mg

Omberacetam (Standard)

Sign In for Pricing
View Details