Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITFG2 Peptide - N-terminal region

ITFG2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ITFG2

UniProt

Q969R8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITFG2 Rabbit Polyclonal Antibody (orb585446) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_060933

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DNDTLNELVVGDTSGKVSVYKNDDSRPWLTCSCQGMLTCVGVGDVCNKGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PFDN2 Antibody
CQA2691-01 30 µL

Anti-PFDN2 Antibody

Sign In for Pricing
View Details
Anti-PFDN2 Antibody
CQA2691-02 50 μL

Anti-PFDN2 Antibody

Sign In for Pricing
View Details
Anti-PFDN2 Antibody
CQA2691-03 100 µL

Anti-PFDN2 Antibody

Sign In for Pricing
View Details
Anti-PFDN2 Antibody
CQA2691-04 200 µL

Anti-PFDN2 Antibody

Sign In for Pricing
View Details
Rat Wingless Type MMTV Integration Site Family, Member 3 (WNT3) ELISA Kit
DL-WNT3-Ra-01 48 Tests

Rat Wingless Type MMTV Integration Site Family, Member 3 (WNT3) ELISA Kit

Sign In for Pricing
View Details
Rat Wingless Type MMTV Integration Site Family, Member 3 (WNT3) ELISA Kit
DL-WNT3-Ra-02 96 Tests

Rat Wingless Type MMTV Integration Site Family, Member 3 (WNT3) ELISA Kit

Sign In for Pricing
View Details