Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITFG2 Peptide - N-terminal region

ITFG2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ITFG2

UniProt

Q969R8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITFG2 Rabbit Polyclonal Antibody (orb585446) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_060933

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DNDTLNELVVGDTSGKVSVYKNDDSRPWLTCSCQGMLTCVGVGDVCNKGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Podoplanin Antibody (rPDPN/6994) [Alexa Fluor 405]
NBP3-20917AF405 0.1 mL

Mouse Monoclonal Podoplanin Antibody (rPDPN/6994) [Alexa Fluor 405]

Sign In for Pricing
View Details
Prostaglandin Transporter (PGT)
P9053-51 100 µg

Prostaglandin Transporter (PGT)

Sign In for Pricing
View Details
Anti-PI4KB Antibody Picoband®, Carrier-free
A04249-2-carrier-free 100 µg/Vial

Anti-PI4KB Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
RNA Polymerase II, Rpb1 subunit, phosphorylated CTD (Ser2/5) (Rpb1, Pol2)
MBS614614-01 0.1 mL

RNA Polymerase II, Rpb1 subunit, phosphorylated CTD (Ser2/5) (Rpb1, Pol2)

Sign In for Pricing
View Details
RNA Polymerase II, Rpb1 subunit, phosphorylated CTD (Ser2/5) (Rpb1, Pol2)
MBS614614-02 5x 0.1 mL

RNA Polymerase II, Rpb1 subunit, phosphorylated CTD (Ser2/5) (Rpb1, Pol2)

Sign In for Pricing
View Details
CD30 (polyclonal), RPab
CCR-0522-01 1 mL

CD30 (polyclonal), RPab

Sign In for Pricing
View Details