TRA2B Peptide - C-terminal region
TRA2B Peptide - C-terminal region
Product Specifications
Product Name Alternative
TRA2B, SFRS10
UniProt
P62995
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRA2B Rabbit Polyclonal Antibody (orb588436) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DGRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYYDRGYDRGYDDRD
More Discoveries
Explore Other Products
Browse additional items from our catalog
037366-ML405 100 µL
KCTD8, CT (KCTD8, BTB/POZ domain-containing protein KCTD8) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
abx550144 96 Tests
Mouse Transmembrane protein 219 (TMEM219) ELISA Kit
Sign In for Pricing
View Details 
A09133-2-HRP 100 µg/Vial
Anti-HOXB6 Antibody Picoband® HRP Conjugated
Sign In for Pricing
View Details