Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF3 Peptide - C-terminal region

TRAF3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRAF3, CAP1, CRAF1

UniProt

Q13114

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRAF3 Rabbit Polyclonal Antibody (orb588445) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLPS siRNA (Human)
MBS8222158-01 15 nmol

CLPS siRNA (Human)

Sign In for Pricing
View Details
CLPS siRNA (Human)
MBS8222158-02 30 nmol

CLPS siRNA (Human)

Sign In for Pricing
View Details
CLPS siRNA (Human)
MBS8222158-03 5x 30 nmol

CLPS siRNA (Human)

Sign In for Pricing
View Details
Vmn2r44 (NM_001105074) Mouse Tagged ORF Clone
MR214644 10 µg

Vmn2r44 (NM_001105074) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Gdap1 shRNA (UAS) - Lentiviral mouse Gdap1 shRNA (UAS, iRFP) plasmid
GTR15184672 1 Vial

Lentiviral mouse Gdap1 shRNA (UAS) - Lentiviral mouse Gdap1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Diethylene Glycol Monopentyl Ether
TRC-D446313-100MG 100 mg

Diethylene Glycol Monopentyl Ether

Sign In for Pricing
View Details