Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF3 Peptide - C-terminal region

TRAF3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRAF3, CAP1, CRAF1

UniProt

Q13114

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRAF3 Rabbit Polyclonal Antibody (orb588445) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Enterovirus 70 (MaxLight 490)
MBS6245402-01 0.1 mL

Enterovirus 70 (MaxLight 490)

Sign In for Pricing
View Details
Enterovirus 70 (MaxLight 490)
MBS6245402-02 5x 0.1 mL

Enterovirus 70 (MaxLight 490)

Sign In for Pricing
View Details
Mouse Monoclonal HGF Antibody (OTI1D2) [PerCP]
NBP2-70884PCP 0.1 mL

Mouse Monoclonal HGF Antibody (OTI1D2) [PerCP]

Sign In for Pricing
View Details
GPA33 (NM_005814) Human Tagged ORF Clone Lentiviral Particle
RC210225L4V 200 µL

GPA33 (NM_005814) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
(R) -2- (9- (Pyridin-2-yl) -6-oxaspiro[4.5]decan-9-yl) acetonitrile
orb3143689-01 10 mg

(R) -2- (9- (Pyridin-2-yl) -6-oxaspiro[4.5]decan-9-yl) acetonitrile

Sign In for Pricing
View Details
(R) -2- (9- (Pyridin-2-yl) -6-oxaspiro[4.5]decan-9-yl) acetonitrile
orb3143689-02 50 mg

(R) -2- (9- (Pyridin-2-yl) -6-oxaspiro[4.5]decan-9-yl) acetonitrile

Sign In for Pricing
View Details