Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF3 Peptide - C-terminal region

TRAF3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRAF3, CAP1, CRAF1

UniProt

Q13114

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRAF3 Rabbit Polyclonal Antibody (orb588446) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TOLLIP Protein (His Tag)
PKSH033125-01 10 µg

Recombinant Human TOLLIP Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human TOLLIP Protein (His Tag)
PKSH033125-02 50 µg

Recombinant Human TOLLIP Protein (His Tag)

Sign In for Pricing
View Details
AOAH Polyclonal Antibody
E-AB-90142-01 60 µL

AOAH Polyclonal Antibody

Sign In for Pricing
View Details
AOAH Polyclonal Antibody
E-AB-90142-02 120 µL

AOAH Polyclonal Antibody

Sign In for Pricing
View Details
AOAH Polyclonal Antibody
E-AB-90142-03 200 µL

AOAH Polyclonal Antibody

Sign In for Pricing
View Details
NRP2 (NM_201266) Human Over-expression Lysate
LY403706 100 µg

NRP2 (NM_201266) Human Over-expression Lysate

Sign In for Pricing
View Details