TRAF5 Peptide - C-terminal region
TRAF5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
TRAF5, RNF84
UniProt
O00463
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRAF5 Rabbit Polyclonal Antibody (orb588447) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_665702
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2067150-01 0.1 mL
HRP-Linked Polyclonal Antibody to Myeloid Cell Leukemia Sequence 1, Bcl2 Related (MCL1)
Sign In for Pricing
View Details MBS2067150-02 0.2 mL
HRP-Linked Polyclonal Antibody to Myeloid Cell Leukemia Sequence 1, Bcl2 Related (MCL1)
Sign In for Pricing
View Details MBS2067150-03 0.5 mL
HRP-Linked Polyclonal Antibody to Myeloid Cell Leukemia Sequence 1, Bcl2 Related (MCL1)
Sign In for Pricing
View Details MBS2067150-04 1 mL
HRP-Linked Polyclonal Antibody to Myeloid Cell Leukemia Sequence 1, Bcl2 Related (MCL1)
Sign In for Pricing
View Details MBS2067150-05 5 mL
HRP-Linked Polyclonal Antibody to Myeloid Cell Leukemia Sequence 1, Bcl2 Related (MCL1)
Sign In for Pricing
View Details MBS2067150-06 5x 5 mL
HRP-Linked Polyclonal Antibody to Myeloid Cell Leukemia Sequence 1, Bcl2 Related (MCL1)
Sign In for Pricing
View Details