Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF5 Peptide - C-terminal region

TRAF5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRAF5, RNF84

UniProt

O00463

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRAF5 Rabbit Polyclonal Antibody (orb588447) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_665702

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Son (NM_019973) Mouse Tagged ORF Clone
MR218347 10 µg

Son (NM_019973) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
BLOC1S2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV683857 1.0 µg DNA

BLOC1S2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PCMV-HA-TRAF6
PPL50003-2a 1 Each

PCMV-HA-TRAF6

Sign In for Pricing
View Details
Human TMEM220 knockdown cell line
ABC-KD15667 1 Vial

Human TMEM220 knockdown cell line

Sign In for Pricing
View Details
Methyl 3- (2-aminoethoxy) propanoate hydrochloride
OR1062400-01 250 mg

Methyl 3- (2-aminoethoxy) propanoate hydrochloride

Sign In for Pricing
View Details
Methyl 3- (2-aminoethoxy) propanoate hydrochloride
OR1062400-02 1 g

Methyl 3- (2-aminoethoxy) propanoate hydrochloride

Sign In for Pricing
View Details