Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XPNPEP1 Peptide - middle region

XPNPEP1 Peptide - middle region

Product Specifications

Product Name Alternative

APP1, SAMP, XPNPEP, XPNPEPL, XPNPEPL1

UniProt

Q9NQW7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with XPNPEP1 Rabbit Polyclonal Antibody (orb327329) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065116

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHRS4 Rabbit Polyclonal Antibody
TA362217 100 µL

DHRS4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TBKBP1 Human Gene Knockout Kit (CRISPR)
KN423867 1 Kit

TBKBP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC6A12 (NM_001122848) Human Over-expression Lysate
LC426579 20 µg

SLC6A12 (NM_001122848) Human Over-expression Lysate

Sign In for Pricing
View Details
TTLL3 (NM_001025930) Human Over-expression Lysate
LC422461 20 µg

TTLL3 (NM_001025930) Human Over-expression Lysate

Sign In for Pricing
View Details
TAS1R3 Rabbit Polyclonal Antibody
TA372669 100 µL

TAS1R3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLN3 (NM_001286110) Human Tagged ORF Clone
RG237882 10 µg

CLN3 (NM_001286110) Human Tagged ORF Clone

Sign In for Pricing
View Details