Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIST4H4 Peptide - N-terminal region

HIST4H4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

H4/p

UniProt

P62805

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIST4H4 Rabbit Polyclonal Antibody (orb327330) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_778224

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Phospho-CRK (Tyr221) Rabbit Monoclonal Antibody
MA4371-.05 50 µL

Anti-Phospho-CRK (Tyr221) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Citric acid anhydrous discontinued. See C5800
267353-01 1 Kg

Citric acid anhydrous discontinued. See C5800

Sign In for Pricing
View Details
Citric acid anhydrous discontinued. See C5800
267353-02 2 Kg

Citric acid anhydrous discontinued. See C5800

Sign In for Pricing
View Details
Citric acid anhydrous discontinued. See C5800
267353-03 5 Kg

Citric acid anhydrous discontinued. See C5800

Sign In for Pricing
View Details
Citric acid anhydrous discontinued. See C5800
267353-04 10 Kg

Citric acid anhydrous discontinued. See C5800

Sign In for Pricing
View Details
Citric acid anhydrous discontinued. See C5800
267353-05 25 Kg

Citric acid anhydrous discontinued. See C5800

Sign In for Pricing
View Details