Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIST4H4 Peptide - N-terminal region

HIST4H4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

H4/p

UniProt

P62805

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIST4H4 Rabbit Polyclonal Antibody (orb327330) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_778224

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPCN2 (Two Pore Calcium Channel Protein 2, Voltage-dependent Calcium Channel Protein TPC2, TPC2) discontinued
T8091-65A 50 µg

TPCN2 (Two Pore Calcium Channel Protein 2, Voltage-dependent Calcium Channel Protein TPC2, TPC2) discontinued

Sign In for Pricing
View Details
Rabbit anti-ROR2 Antibody, Affinity Purified
MBS3904441-01 0.01 mg

Rabbit anti-ROR2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-ROR2 Antibody, Affinity Purified
MBS3904441-02 0.1 mg

Rabbit anti-ROR2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-ROR2 Antibody, Affinity Purified
MBS3904441-03 5x 0.01 mg

Rabbit anti-ROR2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-ROR2 Antibody, Affinity Purified
MBS3904441-04 5x 0.1 mg

Rabbit anti-ROR2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Histone Deacetylase 5 Antibody
MBS5315383-01 0.1 mL

Histone Deacetylase 5 Antibody

Sign In for Pricing
View Details