TTF2 Peptide - N-terminal region
TTF2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
TTF2
UniProt
Q9UNY4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TTF2 Rabbit Polyclonal Antibody (orb588452) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MEEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADTCSFVRATDIPVSHC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-CL-H0499-01 24 Tests
Human COMP (Cartilage Oligomeric Matrix Protein) CLIA Kit
Sign In for Pricing
View Details E-CL-H0499-02 48 Tests
Human COMP (Cartilage Oligomeric Matrix Protein) CLIA Kit
Sign In for Pricing
View Details E-CL-H0499-03 96 Tests
Human COMP (Cartilage Oligomeric Matrix Protein) CLIA Kit
Sign In for Pricing
View Details 