Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YBX3 Peptide - C-terminal region

YBX3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CSDA, DBPA, CSDA1, ZONAB

UniProt

P16989

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YBX3 Rabbit Polyclonal Antibody (orb327332) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PNQPSVRRGYRRPYNYRRRPRPPNAPSQDGKEAKAGEAPTENPAPPTQQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tgds-set siRNA/shRNA/RNAi Lentivector (Mouse)
46587094 4x 500 ng

Tgds-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Human Thyroid Transcription Factor 1 ELISA Kit
IHUTITF1KT 1 Each

Human Thyroid Transcription Factor 1 ELISA Kit

Sign In for Pricing
View Details
ABI2, NT (ABI2, ARGBPIA, Abl interactor 2, Abelson interactor 2, Abl-binding protein 3, Arg-binding protein 1) (APC)
MBS6270618-01 0.2 mL

ABI2, NT (ABI2, ARGBPIA, Abl interactor 2, Abelson interactor 2, Abl-binding protein 3, Arg-binding protein 1) (APC)

Sign In for Pricing
View Details
ABI2, NT (ABI2, ARGBPIA, Abl interactor 2, Abelson interactor 2, Abl-binding protein 3, Arg-binding protein 1) (APC)
MBS6270618-02 5x 0.2 mL

ABI2, NT (ABI2, ARGBPIA, Abl interactor 2, Abelson interactor 2, Abl-binding protein 3, Arg-binding protein 1) (APC)

Sign In for Pricing
View Details
LentimiRa-mmu-miR-101b-5p Vector
mm41107 500 ng

LentimiRa-mmu-miR-101b-5p Vector

Sign In for Pricing
View Details
PSTi8
orb1943405-01 5 mg

PSTi8

Sign In for Pricing
View Details