Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YBX3 Peptide - C-terminal region

YBX3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CSDA, DBPA, CSDA1, ZONAB

UniProt

P16989

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YBX3 Rabbit Polyclonal Antibody (orb327333) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASC3 (Cancer Susceptibility Candidate Gene 3 Protein Homolog, Metastatic Lymph Node Protein 51 Homolog, BTZ, MLN51) (FITC)
MBS6409526-01 0.1 mL

CASC3 (Cancer Susceptibility Candidate Gene 3 Protein Homolog, Metastatic Lymph Node Protein 51 Homolog, BTZ, MLN51) (FITC)

Sign In for Pricing
View Details
CASC3 (Cancer Susceptibility Candidate Gene 3 Protein Homolog, Metastatic Lymph Node Protein 51 Homolog, BTZ, MLN51) (FITC)
MBS6409526-02 5x 0.1 mL

CASC3 (Cancer Susceptibility Candidate Gene 3 Protein Homolog, Metastatic Lymph Node Protein 51 Homolog, BTZ, MLN51) (FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal Exosome component 10 Antibody [DyLight 650]
NBP2-97516C 0.1 mL

Rabbit Polyclonal Exosome component 10 Antibody [DyLight 650]

Sign In for Pricing
View Details
Pacific Blue™ anti-mouse CD44
GT05696 100 µg

Pacific Blue™ anti-mouse CD44

Sign In for Pricing
View Details
ZNF189 Rabbit pAb
E45R23036N-50 50 µL

ZNF189 Rabbit pAb

Sign In for Pricing
View Details
APC Rat IgG2b, κ Isotype Control
JOT22539F 20Tests

APC Rat IgG2b, κ Isotype Control

Sign In for Pricing
View Details