Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YBX3 Peptide - C-terminal region

YBX3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CSDA, DBPA, CSDA1, ZONAB

UniProt

P16989

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YBX3 Rabbit Polyclonal Antibody (orb327333) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMMECR1L sgRNA CRISPR Lentivector set (Human)
K0081501 3x 1.0 µg

AMMECR1L sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Rnf141 qPCR Primer Pair
QM33586S 200 Tests

Mouse Rnf141 qPCR Primer Pair

Sign In for Pricing
View Details
Human TRIP-Br2 protein
orb755154-01 50 µg

Human TRIP-Br2 protein

Sign In for Pricing
View Details
Human TRIP-Br2 protein
orb755154-02 100 µg

Human TRIP-Br2 protein

Sign In for Pricing
View Details
Human TRIP-Br2 protein
orb755154-03 200 µg

Human TRIP-Br2 protein

Sign In for Pricing
View Details
Human TRIP-Br2 protein
orb755154-04 1 mg

Human TRIP-Br2 protein

Sign In for Pricing
View Details