EMC2 Peptide - N-terminal region
EMC2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
EMC2, KIAA0103, TTC35
UniProt
Q15006
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EMC2 Rabbit Polyclonal Antibody (orb327340) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_055488
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP06136PU-N 100 µg
GDNF Receptor alpha 1 (GFRA1) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
