Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KAT7 Peptide - middle region

KAT7 Peptide - middle region

Product Specifications

Product Name Alternative

KAT7, HBO1, HBOa, MYST2

UniProt

O95251

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KAT7 Rabbit Polyclonal Antibody (orb588477) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLSHRQDDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transparent, non-detachable, high binding force, flat bottom , with lid, individually paper-plastic packaged
MBB-TG-DG 1 pcs/box, 100 boxes/ctn

Transparent, non-detachable, high binding force, flat bottom , with lid, individually paper-plastic packaged

Sign In for Pricing
View Details
Tnfrsf4 AAV siRNA Pooled Vector
47217164 1.0 µg

Tnfrsf4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
RFP2 Antibody - middle region : FITC (ARP34143_P050-FITC)
ARP34143_P050-FITC 100 µL

RFP2 Antibody - middle region : FITC (ARP34143_P050-FITC)

Sign In for Pricing
View Details
Rabbit anti-MEK1 Antibody, Affinity Purified
MBS3902565-01 0.01 mg

Rabbit anti-MEK1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-MEK1 Antibody, Affinity Purified
MBS3902565-02 0.1 mg

Rabbit anti-MEK1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-MEK1 Antibody, Affinity Purified
MBS3902565-03 5x 0.01 mg

Rabbit anti-MEK1 Antibody, Affinity Purified

Sign In for Pricing
View Details