Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KAT7 Peptide - middle region

KAT7 Peptide - middle region

Product Specifications

Product Name Alternative

KAT7, HBO1, HBOa, MYST2

UniProt

O95251

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KAT7 Rabbit Polyclonal Antibody (orb588477) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLSHRQDDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bestrophin 2 (BEST2) Rabbit Polyclonal Antibody
TA383817 100 µL

Bestrophin 2 (BEST2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLPX (NM_006660) Human Tagged Lenti ORF Clone
RC215555L4 10 µg

CLPX (NM_006660) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal SLC26A6 Antibody [DyLight 550]
NBP2-98638R 0.1 mL

Rabbit Polyclonal SLC26A6 Antibody [DyLight 550]

Sign In for Pricing
View Details
Human KCNK18 Pre-designed siRNA Set A
SI008038A 1 Each

Human KCNK18 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Dip2c 3'UTR Lenti-reporter-Luc Vector
18237084 1.0 µg

Dip2c 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
H-Cys (Bzl) -OMe.HCl 25g
A23660-25000 25000 mg

H-Cys (Bzl) -OMe.HCl 25g

Sign In for Pricing
View Details