Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFIP11 Peptide - N-terminal region

TFIP11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NTR1, STIP, TIP39, STIP-1, Spp382, bK445C9.6

UniProt

Q9UBB9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFIP11 Rabbit Polyclonal Antibody (orb327365) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_036275

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SHLYRDGEGRIDDDDDERENFEITDWDLQNEFNPNRQRHWQTKEEATYGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2A.X, phosphorylated (Ser139) (H2a/x, H2AFX, H2AX) (PE)
MBS6011732-01 0.1 mL

Histone H2A.X, phosphorylated (Ser139) (H2a/x, H2AFX, H2AX) (PE)

Sign In for Pricing
View Details
Histone H2A.X, phosphorylated (Ser139) (H2a/x, H2AFX, H2AX) (PE)
MBS6011732-02 5x 0.1 mL

Histone H2A.X, phosphorylated (Ser139) (H2a/x, H2AFX, H2AX) (PE)

Sign In for Pricing
View Details
ASC/TMS1 Rabbit Polyclonal Antibody (AP)
orb1810093 100 µL

ASC/TMS1 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Transgelin-3 Overexpression Lysate (Native) - (Dry Ice)
NBL1-16694 0.1 mg

Transgelin-3 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Rat protein kinase K9 (PKK9) ELISA Kit
201-11-0205 96 Tests

Rat protein kinase K9 (PKK9) ELISA Kit

Sign In for Pricing
View Details
Anti-EDNRB Antibody Picoband® (monoclonal, 15C3), PE Conjugate
M01041-1-PE 100 µg/Vial

Anti-EDNRB Antibody Picoband® (monoclonal, 15C3), PE Conjugate

Sign In for Pricing
View Details