Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HINFP Peptide - C-terminal region

HINFP Peptide - C-terminal region

Product Specifications

Product Name Alternative

HINFP, MIZF, ZNF743

UniProt

Q9BQA5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HINFP Rabbit Polyclonal Antibody (orb588496) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_945322

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGTSLNESS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DHRS3 Antibody [Alexa Fluor 350]
NBP2-99196AF350 0.1 mL

Rabbit Polyclonal DHRS3 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Human Kallikrein 9 (KLK9) ELISA Kit
MBS455897-01 48 Tests

Human Kallikrein 9 (KLK9) ELISA Kit

Sign In for Pricing
View Details
Human Kallikrein 9 (KLK9) ELISA Kit
MBS455897-02 96 Tests

Human Kallikrein 9 (KLK9) ELISA Kit

Sign In for Pricing
View Details
Human Kallikrein 9 (KLK9) ELISA Kit
MBS455897-03 5x 96 Tests

Human Kallikrein 9 (KLK9) ELISA Kit

Sign In for Pricing
View Details
Human Kallikrein 9 (KLK9) ELISA Kit
MBS455897-04 10x 96 Tests

Human Kallikrein 9 (KLK9) ELISA Kit

Sign In for Pricing
View Details
Tas2r113 3'UTR Lenti-reporter-Luc Vector
46149086 1.0 µg

Tas2r113 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details