Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARVA Peptide - N-terminal region

PARVA Peptide - N-terminal region

Product Specifications

Product Name Alternative

PARVA, MXRA2

UniProt

Q9NVD7

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARVA Rabbit Polyclonal Antibody (orb588516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1A (PPP1CA) Rabbit Polyclonal Antibody
TA380230 100 µL

PPP1A (PPP1CA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TMEM143 activation kit by CRISPRa
GA110653 1 Kit

Human TMEM143 activation kit by CRISPRa

Sign In for Pricing
View Details
(S)-Trifluorolactic Acid
TRC-T790500-50MG 50 mg

(S)-Trifluorolactic Acid

Sign In for Pricing
View Details
Polystyrene C4 OH
HB04508000.25G 25 g

Polystyrene C4 OH

Sign In for Pricing
View Details
Prostaglandin E1
TRC-P838600-5MG 5 mg

Prostaglandin E1

Sign In for Pricing
View Details
H3FA (HIST1H3A) pThr3 Rabbit Polyclonal Antibody
AP20891PU-N 100 µg

H3FA (HIST1H3A) pThr3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details