PARVA Peptide - N-terminal region
PARVA Peptide - N-terminal region
Product Specifications
Product Name Alternative
PARVA, MXRA2
UniProt
Q9NVD7
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PARVA Rabbit Polyclonal Antibody (orb588516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC432783 20 µg
C3orf26 (CMSS1) (NM_001167924) Human Over-expression Lysate
Sign In for Pricing
View Details 
GP-8003-10 1 mL
Colloidal Gold Conjugated Aegopodium podagraria Lectin (Ground Elder) -APP-, 10nm
Sign In for Pricing
View Details 
