PRX Peptide - C-terminal region
PRX Peptide - C-terminal region
Product Specifications
Product Name Alternative
CMT4F
UniProt
Q9BXM0
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PRX Rabbit Polyclonal Antibody (orb327383) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SRGQEGDAAPKSPVREKSPKFRFPRVSLSPKARSGSGDQEEGGLRVRLPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDR-PROCR-b-01 96 Tests
Bovine Protein C Receptor, Endothelial (PROCR) ELISA Kit
Sign In for Pricing
View Details RDR-PROCR-b-02 48 Tests
Bovine Protein C Receptor, Endothelial (PROCR) ELISA Kit
Sign In for Pricing
View Details 
